PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10008576m
Common NameEUTSA_v10008576mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 251aa    MW: 29621.8 Da    PI: 9.4243
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10008576mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.42.5e-301059251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     +ienk+nrqvtfskRr+g+lKKA+E+SvLCdaev++i+fs++gkl+eyss
  Thhalv10008576m 10 KIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVSLIVFSHKGKLFEYSS 59
                     69**********************************************96 PP

2K-box100.91.7e-33761742100
            K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                      ++++ k+ +++ + +++ e+++Lk++ie L+r+qR++lGedLes+slkeLq LeqqLe+slk+iR +Kn+l++e++++lq+keke+qeen +L 
  Thhalv10008576m  76 AERQLKAPDSHVNTNWSMEYSRLKAKIELLERNQRRYLGEDLESMSLKELQFLEQQLETSLKHIRFRKNQLMYESLNHLQRKEKEIQEENSMLA 169
                      56666776777789******************************************************************************** PP

            K-box  96 kklee 100
                      k+++e
  Thhalv10008576m 170 KQIKE 174
                      **986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.637161IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-39160IPR002100Transcription factor, MADS-box
CDDcd002651.71E-42279No hitNo description
SuperFamilySSF554557.19E-34291IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-303859IPR002100Transcription factor, MADS-box
PfamPF014866.8E-2985172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.53988178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGRGRVEMRK IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVSLIVFSH KGKLFEYSSE  60
PCMEKVLERY ERYSYAERQL KAPDSHVNTN WSMEYSRLKA KIELLERNQR RYLGEDLESM  120
SLKELQFLEQ QLETSLKHIR FRKNQLMYES LNHLQRKEKE IQEENSMLAK QIKERESILK  180
THQNQQEQQN RSHHIPPQPQ LHPYMTSHQT SPFLKMGGLY QGEDPTAVRR NNLDLTLEPI  240
YNCNLGCFAA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S3e-20174173Myocyte-specific enhancer factor 2B
1tqe_R3e-20174173Myocyte-specific enhancer factor 2B
1tqe_Q3e-20174173Myocyte-specific enhancer factor 2B
1tqe_P3e-20174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5140450.0AY514045.1 Brassica rapa var. communis DNA binding protein (CAL) mRNA, complete cds.
GenBankAY5140480.0AY514048.1 Brassica rapa subsp. rapa DNA binding protein (CAL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006415910.10.0hypothetical protein EUTSA_v10008576mg
SwissprotQ9SBK91e-165CAL_BRARP; Transcription factor CAULIFLOWER
TrEMBLV4L3E00.0V4L3E0_EUTSA; Uncharacterized protein
STRINGBra011021.1-P1e-163(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79225110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26310.11e-141MIKC_MADS family protein